PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof003178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family DBB
Protein Properties Length: 257aa    MW: 27706.8 Da    PI: 4.656
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-73597PU_refplantGDBView CDS
PUT-157a-Saccharum_officinarum-73598PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.5e-07446541
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sof003178  4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
               7******99*********************6678888898877 PP

2zf-B_box279.6e-095385234
   zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
               + ++C+ ++ek + +fC +++ l+C+dC + +H
  Sof003178 53 KLPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 85
               5789**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.011147IPR000315B-box-type zinc finger
CDDcd000212.53E-6347No hitNo description
SMARTSM003362.1E-9447IPR000315B-box-type zinc finger
PfamPF006431.2E-5447IPR000315B-box-type zinc finger
SMARTSM003365.4E-145299IPR000315B-box-type zinc finger
PROSITE profilePS501198.7885299IPR000315B-box-type zinc finger
PfamPF006431.4E-65395IPR000315B-box-type zinc finger
CDDcd000216.10E-75585No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MKIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLEAL SAKLPRCDVC  60
QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT GIRVGFASAS ACSDGACDAH  120
DYDHHAPPKA TIEPPQATVS AAAQQVPSPP QFLPQGWAVD ELLQFSDYES SDKLHKESPL  180
GFKELEWFAD IDLFHEQAPK AGRTSAEVPE PFGSQAPNDA AYYRPAKAAA GAGVRQSKKA  240
PIEVTDDEDY FIVXDLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.106331e-180callus| crown| inflorescence| leaf| meristem| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151151.11e-165uncharacterized protein LOC100284784
TrEMBLB6TXF71e-165B6TXF7_MAIZE; Salt tolerance-like protein
TrEMBLB4FR481e-165B4FR48_MAIZE; Uncharacterized protein
STRINGSb04g025400.11e-162(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.11e-70DBB family protein